Speakenglishwithtiffaniacademy.com valuation and analysis

Speakenglishwithtiffaniacademy.com has global traffic rank of 491,709. Its global rank has gone up by 1,081,600 positions since 3 months ago. Speakenglishwithtiffaniacademy.com has an estimated worth of US$ 35,073, based on its estimated Ads revenue. Speakenglishwithtiffaniacademy.com receives approximately 6,406 unique visitors each day. Its web server is located in United States, with IP address 104.27.129.146. According to SiteAdvisor, speakenglishwithtiffaniacademy.com is safe to visit.

HTTP/1.1 302 Found
Date: Tue, 07 Jan 2020 08:46:34 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Set-Cookie: __cfduid=d74bb1ed361a4658e902e46c753aa10131578386794; expires=Thu, 06-Feb-20 08:46:34 GMT; path=/; domain=.speakenglishwithtiffaniacademy.com; HttpOnly; SameSite=Lax
Location: https://speakenglishwithtiffaniacademy.com/
Cache-Control: private, no-store, must-revalidate
X-Request-Id: 51092243-5f37-4685-af55-70151a426607
X-Runtime: 0.006007
Vary: Accept-Encoding
X-Content-Type-Options: nosniff
X-Download-Options: noopen
X-Frame-Options: SAMEORIGIN
X-Permitted-Cross-Domain-Policies: none
X-XSS-Protection: 1; mode=block
CF-Cache-Status: DYNAMIC
Server: cloudflare
CF-RAY: 5514a976dd1234d4-LHR

HTTP/2 200 
date: Tue, 07 Jan 2020 08:46:34 GMT
content-type: text/html; charset=utf-8
set-cookie: __cfduid=ded7c9492bc857f1d5194766b61b0b07d1578386794; expires=Thu, 06-Feb-20 08:46:34 GMT; path=/; domain=.speakenglishwithtiffaniacademy.com; HttpOnly; SameSite=Lax
x-fedora-school-id: 76970
cache-control: max-age=0, private, must-revalidate
strict-transport-security: max-age=0
set-cookie: ahoy_visitor=b77df2e3-3e1e-409a-8326-eee1bb73ad01; path=/; expires=Fri, 07 Jan 2022 08:46:34 -0000
set-cookie: ahoy_visit=5ce1149d-9497-4237-843f-bb7ca9ee0ae8; path=/; expires=Tue, 07 Jan 2020 12:46:34 -0000
set-cookie: _afid=b77df2e3-3e1e-409a-8326-eee1bb73ad01; domain=.speakenglishwithtiffaniacademy.com; path=/; expires=Thu, 07 Jan 2021 08:46:34 -0000
set-cookie: aid=b77df2e3-3e1e-409a-8326-eee1bb73ad01; domain=.speakenglishwithtiffaniacademy.com; path=/; expires=Thu, 07 Jan 2021 08:46:34 -0000
set-cookie: site_preview=logged_out; path=/
set-cookie: _session_id=b30a83b764b1f905c7c729eb50c85ac6; path=/; expires=Thu, 06 Feb 2020 08:46:34 -0000; HttpOnly
x-request-id: 08bb7277-0fa2-42bc-8474-ec2a712edcf5
x-runtime: 0.157748
vary: Accept-Encoding
x-content-type-options: nosniff
x-download-options: noopen
x-frame-options: SAMEORIGIN
x-permitted-cross-domain-policies: none
x-xss-protection: 1; mode=block
cf-cache-status: DYNAMIC
expect-ct: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
server: cloudflare
cf-ray: 5514a978dd99e65c-LHR

   Domain Name: SPEAKENGLISHWITHTIFFANIACADEMY.COM
   Registry Domain ID: 2339788521_DOMAIN_COM-VRSN
   Registrar WHOIS Server: whois.namecheap.com
   Registrar URL: http://www.namecheap.com
   Updated Date: 2019-11-04T12:38:12Z
   Creation Date: 2018-12-04T11:15:30Z
   Registry Expiry Date: 2020-12-04T11:15:30Z
   Registrar: NameCheap, Inc.
   Registrar IANA ID: 1068
   Registrar Abuse Contact Email: abuse@namecheap.com
   Registrar Abuse Contact Phone: +1.6613102107
   Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Name Server: DILBERT.NS.CLOUDFLARE.COM
   Name Server: ZARA.NS.CLOUDFLARE.COM
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

Domain name: speakenglishwithtiffaniacademy.com
Registry Domain ID: 2339788521_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2019-11-04T12:38:12.35Z
Creation Date: 2018-12-04T11:15:30.00Z
Registrar Registration Expiration Date: 2020-12-04T11:15:30.00Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited 
Registry Registrant ID: 
Registrant Name: WhoisGuard Protected
Registrant Organization: WhoisGuard, Inc.
Registrant Street: P.O. Box 0823-03411 
Registrant City: Panama
Registrant State/Province: Panama
Registrant Postal Code: 
Registrant Country: PA
Registrant Phone: +507.8365503
Registrant Phone Ext: 
Registrant Fax: +51.17057182
Registrant Fax Ext: 
Registrant Email: 8b1cfcabe17844c7a17c20a574153f6a.protect@whoisguard.com
Registry Admin ID: 
Admin Name: WhoisGuard Protected
Admin Organization: WhoisGuard, Inc.
Admin Street: P.O. Box 0823-03411 
Admin City: Panama
Admin State/Province: Panama
Admin Postal Code: 
Admin Country: PA
Admin Phone: +507.8365503
Admin Phone Ext: 
Admin Fax: +51.17057182
Admin Fax Ext: 
Admin Email: 8b1cfcabe17844c7a17c20a574153f6a.protect@whoisguard.com
Registry Tech ID: 
Tech Name: WhoisGuard Protected
Tech Organization: WhoisGuard, Inc.
Tech Street: P.O. Box 0823-03411 
Tech City: Panama
Tech State/Province: Panama
Tech Postal Code: 
Tech Country: PA
Tech Phone: +507.8365503
Tech Phone Ext: 
Tech Fax: +51.17057182
Tech Fax Ext: 
Tech Email: 8b1cfcabe17844c7a17c20a574153f6a.protect@whoisguard.com
Name Server: dilbert.ns.cloudflare.com 
Name Server: zara.ns.cloudflare.com 
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/